Online Inquiry
VprBP Antibody
SPA-11813
| Size | Price |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | VprBP |
| Gene Abbr. | DCAF1 |
| Gene ID | 9730 |
| Full Name | DDB1 and CUL4 associated factor 1 |
| Alias | RIP, VPRBP |
| Introduction | VPRBP binds and bridges the CUL4 and DDB1 ubiquitin ligase complex, binding the DNA damage binding protein DDB1 and CUL4. VPRBP is the acronym for the human immunodeficiency virus type-1 Vpr binding protein. CUL4 is a cullin family memember. Cullins are ubiquitin ligases that are cable of ubiquitinylating a wide range of protein substrates. All ubiquitin ligases are important as the modification of proteins by ubiquitin addition modifies or activates functionality. VPRBP is critical for normal cell cycle progression through S phase and allows proper cell proliferation and development. VPRBP appears to serve in an epigenetic role through regulation of histone methylation. VPRBP antibody provides a reagent for exploration of ubiqitin ligase activities in cell cycle and other cell pathways responsible for normal cell growth and function. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to the following amino acid sequence: SAKQGDRENFRKAKQKLGFSSSDPDRMFVELSNSSWSEMSPWVIGTNYTLYPMTPAIEQRLILQYLTPLGEYQELLPIFMQLGSRELMMFYIDLKQTNDVLL. |
| Usage | |
|---|---|
| Application | IF |
| Dilutions | Immunofluorescence (0.25-2 µg/mL) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human VprBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.