VprBP Antibody - CD BioSciences

service-banner

VprBP Antibody

VprBP Antibody

SPA-11812

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name VprBP
Gene Abbr. DCAF1
Gene ID 9730
Full Name DDB1 and CUL4 associated factor 1
Alias RIP, VPRBP
Introduction VPRBP binds and bridges the CUL4 and DDB1 ubiquitin ligase complex, binding the DNA damage binding protein DDB1 and CUL4. VPRBP is the acronym for the human immunodeficiency virus type-1 Vpr binding protein. CUL4 is a cullin family memember. Cullins are ubiquitin ligases that are cable of ubiquitinylating a wide range of protein substrates. All ubiquitin ligases are important as the modification of proteins by ubiquitin addition modifies or activates functionality. VPRBP is critical for normal cell cycle progression through S phase and allows proper cell proliferation and development. VPRBP appears to serve in an epigenetic role through regulation of histone methylation. VPRBP antibody provides a reagent for exploration of ubiqitin ligase activities in cell cycle and other cell pathways responsible for normal cell growth and function.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: IAHIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNMNISGVFHPNGLEVIINTEIWD.
Usage
Application IF, IHC
Dilutions Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:20-1:50)
Reactivity Human, Mouse, Rat
Specificity Specificity of human VprBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.