Online Inquiry
VEGF Receptor 1 Antibody
SPA-11715
Size | Price |
0.025 mL | Online Inquiry |
0.1 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | VEGF Receptor |
Gene Abbr. | FLT1 |
Gene ID | 2321 |
Full Name | fms related receptor tyrosine kinase 1 |
Alias | FLT, FLT-1, VEGFR-1, VEGFR1 |
Introduction | The vascular endothelial growth factor (VEGF) receptor (VEGFR-1, Flt-1) is a 180 kDa receptor tyrosine kinase belonging to the VEGFR (Flt) family. The receptor is comprised of seven extracellular Ig-like domains, a single transmembrane region and cytoplasmic tail containing the active kinase domain. VEGFR-1 plays an important role in endothelial cell function and normal vascular development, as well as in hematopoietic function. VEGF-A is a high affinity ligand of VEGFR-1. VEGFR-1 also binds VEGF-B and PLGF. Ligand binding results in very little VEGFR-1 kinase activation, and VEGFR-1/VEGF-A binding negatively regulates VEGF function by diverting the growth factor from other functional VEGF receptors.Two forms of the VEGF receptor 1 are found in cells. Both the membrane-bound form described above and a soluble isoform of VEGFR-1 (sVEGFR-1 or sFlt-1) bind the VEGF ligand with high affinity. Full-length VEGFR-1 and the truncated, soluble protein are encoded by the same gene and are generated through differential splicing. Both proteins are associated with an array of human disorders and are potential candidates for therapeutic study. |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | CL0344 |
Isotype | IgG1 |
Immunogen | Recombinant Protein corresponding to amino acids: LNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIERVTEEDEGVYHCKATNQKGS. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:200-1:500) |
Reactivity | Human |
Specificity | Specificity of human VEGFR1/Flt-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.