VEGF Receptor 1 Antibody - CD BioSciences

service-banner

VEGF Receptor 1 Antibody

VEGF Receptor 1 Antibody

SPA-11712

Size Price
0.025 mL Online Inquiry
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name VEGF Receptor
Gene Abbr. FLT1
Gene ID 2321
Full Name fms related receptor tyrosine kinase 1
Alias FLT, FLT-1, VEGFR-1, VEGFR1
Introduction The vascular endothelial growth factor (VEGF) receptor (VEGFR-1, Flt-1) is a 180 kDa receptor tyrosine kinase belonging to the VEGFR (Flt) family. The receptor is comprised of seven extracellular Ig-like domains, a single transmembrane region and cytoplasmic tail containing the active kinase domain. VEGFR-1 plays an important role in endothelial cell function and normal vascular development, as well as in hematopoietic function. VEGF-A is a high affinity ligand of VEGFR-1. VEGFR-1 also binds VEGF-B and PLGF. Ligand binding results in very little VEGFR-1 kinase activation, and VEGFR-1/VEGF-A binding negatively regulates VEGF function by diverting the growth factor from other functional VEGF receptors.Two forms of the VEGF receptor 1 are found in cells. Both the membrane-bound form described above and a soluble isoform of VEGFR-1 (sVEGFR-1 or sFlt-1) bind the VEGF ligand with high affinity. Full-length VEGFR-1 and the truncated, soluble protein are encoded by the same gene and are generated through differential splicing. Both proteins are associated with an array of human disorders and are potential candidates for therapeutic study.
Product Details
Host Mouse
Clonality Monoclonal
Clone No. CL0345
Isotype IgG2B
Immunogen Recombinant Protein corresponding to amino acids: LNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIERVTEEDEGVYHCKATNQKGS.
Usage
Application WB, IHC
Dilutions Western Blot (1 µg/mL); Immunohistochemistry (1:200-1:500)
MW(KDa) 180, 200
Reactivity Human
Specificity Specificity of human VEGFR1/Flt-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.