UBR7 Antibody - CD BioSciences

service-banner

UBR7 Antibody

UBR7 Antibody

SPA-11605

Size Price
100 µL Online Inquiry
20 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name UBR7
Gene Abbr. UBR7
Gene ID 55148
Full Name ubiquitin protein ligase E3 component n-recognin 7
Alias C14orf130
Introduction E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific amino-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the middle region of human UBR7. Peptide sequence: MIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAV The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB, IHC
Reactivity Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.