TRADD Antibody - CD BioSciences

service-banner

TRADD Antibody

TRADD Antibody

SPA-11202

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name TRADD
Gene Abbr. TRADD
Gene ID 8717
Full Name TNFRSF1A associated via death domain
Alias Hs.89862
Introduction Apoptosis mediated by death factors like FasL and TNF-α involves the formation of a death-inducing signaling complex (DISC) to their respective receptors. Upon ligand activation to their receptors, Fas and TNF-R1 associate with death domain (DD) containing adaptor proteins FADD (Fas associated death domain) and TRADD (TNF-R1 associated death domain). In addition to its carboxy-terminal DD, FADD contains an amino-terminal death effector domain (DED) that binds to DEDs found on caspase-8 which leads to activation of this initiator caspase. Caspase-8 subsequently activates downstream effector caspases, like caspase-3, resulting in the cleavage of proteins involved in the execution of apoptosis. Unlike FADD, TRADD does not contain a DED. Apoptosis driven by TNF-R1 binding to TRADD involves association of TRADD and FADD which then leads to activation of caspase-8.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: NGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRVLQ.
Usage
Application IHC
Dilutions Immunohistochemistry (1:200-1:500)
MW(KDa) 32
Reactivity Human
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.