Online Inquiry
Toll-like Receptor 6/TLR6 Antibody
SPA-11136
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Toll-like Receptor |
Gene Abbr. | TLR6 |
Gene ID | 10333 |
Full Name | toll like receptor 6 |
Alias | CD286 |
Introduction | Members of the Toll-like receptor (TLR) family, named for the closely related Toll receptor in Drosophila, play a pivotal role in innate immune responses. TLRs recognize conserved motifs found in various pathogens and mediate defense responses. Triggering of the TLR pathway leads to the activation of NF-κB and subsequent regulation of immune and inflammatory genes. The TLRs and members of the IL-1 receptor family share a conserved stretch of approximately 200 amino acids known as the Toll/Interleukin-1 receptor (TIR) domain. Upon activation, TLRs associate with a number of cytoplasmic adaptor proteins containing TIR domains, including myeloid differentiation factor 88 (MyD88), MyD88-adaptor-like/TIR-associated protein (MAL/TIRAP), Toll-receptor-associated activator of interferon (TRIF), and Toll-receptor-associated molecule (TRAM). This association leads to the recruitment and activation of IRAK1 and IRAK4, which form a complex with TRAF6 to activate TAK1 and IKK.Activation of IKK leads to the degradation of IκB, which normally maintains NF-κB in an inactive state by sequestering it in the cytoplasm.Toll-like receptor 6 (TLR6) heterodimerizes with TLR2 and is expressed on the cell surface where it recognizes fungal zymosan and bacterial lipoproteins. In addition, a heterodimer of TLR4 and TLR6 was recently shown to assemble downstream of CD36 signaling and contribute to sterile inflammation in response to CD36 ligands, including low-density lipoprotein and β-amyloid. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Synthetic peptides corresponding to TLR6(toll-like receptor 6) The peptide sequence was selected from the middle region of TLR6. Peptide sequence KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT. The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (1:100-1:2000); Immunohistochemistry (1:10-1:500) |
MW(KDa) | 90-110 |
Reactivity | Human, Mouse, Rat |
Storage & Handling | |
---|---|
Storage Buffer | PBS and 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at -20 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.