TNFRSF8/CD30 Antibody - CD BioSciences

service-banner

TNFRSF8/CD30 Antibody

TNFRSF8/CD30 Antibody

SPA-10992

Size Price
100 µg Online Inquiry
25 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name TNF receptor
Gene Abbr. TNFRSF8
Gene ID 943
Full Name TNF receptor superfamily member 8
Alias CD30, D1S166E, Ki-1
Introduction TNFRSF8/CD30 is a type-I transmembrane glycoprotein that is a member of the TNFR superfamily. CD30 is synthesized as a precursor protein that undergoes extensive posttranslational modification before becoming embedded in the plasma membrane as a 120-kDa transmembrane protein. The expression of CD30 is upregulated in activated T-cells and may trigger costimulatory signaling pathways upon its engagement. While its expression is normally restricted to subsets of activated T-cells and B-cells, CD30 expression is robustly upregulated in hematologic malignancies, such as Hodgkin’s lymphoma anaplastic large cell lymphoma (ALCL), and adult T-cell leukemia, thus making it an attractive target for therapeutic intervention. Research studies have suggested that in certain disease contexts, CD30 recruits TRAF2 and TRAF5 adaptor proteins to drive NF-kappa B activation, aberrant cell growth, and cytokine production. CD30 signaling is also regulated by TACE-dependent proteolytic cleavage of its ectodomain, which results in reduced CD30L-dependent activation of CD30+ cells.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: DTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTS.
Usage
Application IHC
Dilutions Immunohistochemistry (1:500-1:1000)
Reactivity Human
Specificity Specificity of human CD30/TNFRSF8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.