Online Inquiry
TNF-R2 Antibody
SPA-10920
Size | Price |
100 µg | Online Inquiry |
25 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | TNF receptor |
Gene Abbr. | TNFRSF1B |
Gene ID | 7133 |
Full Name | TNF receptor superfamily member 1B |
Alias | CD120b, TBPII, TNF-R-II, TNF-R75, TNFBR |
Introduction | TNF-α is an important cytokine produced by numerous cell types including neutrophils, activated lymphoctyes, macrophages and NK cells. It plays a critical role in inflammatory responses and in apoptosis. TNF-α exists as a membrane-anchored and soluble form, both of which show biological activity. Response to TNF-α is mediated through two receptors, TNF-R1, which is widely expressed, and TNF-R2, which is expressed mainly in immune and endothelial cells. Antagonists to TNF-α have been validated as therapeutic targets for rheumatoid arthritis and other immune disorders.The two receptors for TNF-α, TNF-R1 (55 kDa) and TNF-R2 (75 kDa) can mediate distinct cellular responses. In most cases cytotoxicity elicited by TNF has been reported to act throught TNF-R1. In contrast, TNF-R2 appears to be important in T cell signaling and responses to infection. TNF-R2 binds to distinct members of the TRAF family leading to the activation of NF-κB. Soluble forms of both receptors have also been characterized which can bind TNF-α and may play an important role in immune disorders. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: HAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVV. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:50-1:200) |
MW(KDa) | 65 |
Reactivity | Human |
Specificity | Specificity of human TNF RII/TNFRSF1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.