TGF-β 1 Antibody - CD BioSciences

service-banner

TGF-β 1 Antibody

TGF-β 1 Antibody

SPA-10684

Size Price
100 µL Online Inquiry
20 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name TGF-β
Gene Abbr. TGFB1
Gene ID 7040
Full Name transforming growth factor beta 1
Alias CED, DPD1, IBDIMDE, LAP, TGF-beta1
Introduction Transforming growth factor-β (TGF-β) superfamily members are critical regulators of cell proliferation and differentiation, developmental patterning and morphogenesis, and disease pathogenesis. TGF-β elicits signaling through three cell surface receptors: type I type II (RII), and type III (RIII). Type I and type II receptors are serine/threonine kinases that form a heteromeric complex. In response to ligand binding, the type II receptors form a stable complex with the type I receptors allowing phosphorylation and activation of type I receptor kinases. The type III receptor, also known as betaglycan, is a transmembrane proteoglycan with a large extracellular domain that binds TGF-β with high affinity but lacks a cytoplasmic signaling domain. Expression of the type III receptor can regulate TGF-β signaling through presentation of the ligand to the signaling complex. The only known direct TGF-β signaling effectors are the Smad family proteins, which transduce signals from the cell surface directly to the nucleus to regulate target gene transcription.There are three TGF-beta family members, designated TGF-β1, TGF-β2, and TGF-β3, which are encoded by distinct genes and are expressed in a tissue specific manner. TGF-β proteins are synthesized as precursor proteins that are cleaved and reassembled in association with other proteins to form latent complexes. Activation occurs by proteolytic release of TGF-β monomers, which dimerize to form the mature TGF-β ligands.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptite directed towards the middle region of mouse TGFB1. Peptide sequence DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB, IF, IHC
Dilutions Immunofluorescence (5-10 µg/mL); Immunohistochemistry (1:10-1:500)
MW(KDa) 12
Reactivity Human, Mouse, Porcine, Rat
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.