Online Inquiry
TDAG8/GPR65 Antibody
SPA-04754
| Size | Price |
| 0.05 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | GPR65 |
| Gene Abbr. | GPR65 |
| Gene ID | 8477 |
| Full Name | G protein-coupled receptor 65 |
| Alias | TDAG8, hTDAG8 |
| Introduction | Human G Protein-Coupled Receptor 65 (GPR65), also known as T-Cell Death-Associated Gene 8 Protein (TDAG8) and Psychosine Receptor, is a 337 aminoacids proton-sensing GPCR primarily expressed in lymphoid tissues and is uniquely expressed in Th17 cells; mice deficient in GPR65 are resistant to autoimmunity. GPR65 senses pH by protonation of histidine residues on its extracellular domain. Many pH-sensing G protein-coupled receptors have emerged as potential therapeutic agents in conditions that involve the response to acidotic stress. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to the following amino acid sequence: ETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEV. |
| Usage | |
|---|---|
| Application | IF |
| Dilutions | Immunofluorescence (0.25-2 µg/mL) |
| Reactivity | Human |
| Specificity | Specificity of human TDAG8/GPR65 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.