Online Inquiry
TANK Antibody
SPA-10575
Size | Price |
0.025 mL | Online Inquiry |
0.05 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | TANK |
Gene Abbr. | TANK |
Gene ID | 10010 |
Full Name | TRAF family member associated NFKB activator |
Alias | I-TRAF, ITRAF, TRAF2 |
Introduction | TRAF (tumor necrosis factor receptor-associated factor) family member-associated NF-kappaB activator (TANK) maintains TRAF1, TRAF2 and TRAF3 proteins in their latent states (cytoplasmic sequestration). TANK binds to their TRAF-c domains inhibiting TRAF signaling and NF kappa B activation. TANK may function as an adaptor molecule in multiple antiviral pathways. Two transcript variants encoding different isoforms for this gene have been found. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: EQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLT. |
Usage | |
---|---|
Application | WB, IF, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:20-1:50) |
Reactivity | Human |
Specificity | Specificity of human TANK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.