Online Inquiry
TACI/TNFRSF13B/CVID Antibody
SPA-10842
| Size | Price |
| 0.025 mg | Online Inquiry |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | TNF receptor |
| Gene Abbr. | TNFRSF13B |
| Gene ID | 23495 |
| Full Name | TNF receptor superfamily member 13B |
| Alias | CD267, CVID, CVID2, IGAD2, RYZN |
| Introduction | Members in the TNF superfamily regulate immune responses and induce apoptosis. Two novel members in the TNF family were recently identified and designated BAFF/BLyS/TALL-1/THANK/zTNF4 and April/TALL-2, respectively. BAFF was characterized as a B cell activator since it induced B cell proliferation and immunoglobulin secretion. April regulates immunological and non-immunological cell growth. Three receptors, BCMA, TACI, and BAFF-R, for BAFF and April were recently identified. TACI, like BCMA, binds BAFF and April. TACI and its ligands regulate humoral immune responses, activate NF-kappaB and c-jun N-terminal kinase, and are involved in B cell associated autoimmune diseases. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: ACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQE. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:20-1:50) |
| Reactivity | Human |
| Specificity | Specificity of human TACI/TNFRSF13B/CVID antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.