Spry1 Antibody - CD BioSciences

service-banner

Spry1 Antibody

Spry1 Antibody

SPA-10263

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name Spry1
Gene Abbr. SPRY1
Gene ID 10252
Full Name sprouty RTK signaling antagonist 1
Alias hSPRY1
Introduction Spry1 is a member of the Sprouty (Spry) family proteins that was initially identified in Drosophila as an inhibitor of the FGF signaling pathway. There are four human Spry proteins (Spry1-4), encoded by different genes, and they all share a highly conserved carboxy-terminal cystine-rich Spry domain that is known to be essential for their receptor tyrosine kinase inhibitory function stimulated by various growth factors. Spry1 and other Spry proteins play a key role in embryonic development, tissue and organ formation, as well as growth in almost all living organisms. Spry proteins are considered tumor suppressors due to their inhibitory function in a variety of growth factor signaling pathways. Spry1 anchors itself to the membrane by palmitoylation and can translocate from the cytosol to the membrane by binding to caveolin-1. Regulation of Spry1 protein function is thought to occur at various levels. Spry1 regulation includes transcriptional regulation by growth factors and kinases, post-transcriptional regulation by microRNA-21, post-translational modifications including phosphorylation, dephosphorylation, ubiquitination and proteasomal degradation, and regulation by its interacting protein partners.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKC.
Usage
Application WB, IF
Dilutions Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL)
MW(KDa) 35
Reactivity Human
Specificity Specificity of human SPRY1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.