Online Inquiry
SOS2 Antibody
SPA-10245
| Size | Price |
| 100 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | SOS |
| Gene Abbr. | SOS2 |
| Gene ID | 6655 |
| Full Name | SOS Ras/Rho guanine nucleotide exchange factor 2 |
| Alias | NS9, SOS-2 |
| Introduction | Son of sevenless (SOS) was first identified in Drosophila as a guanine nucleotide exchange factor (GEF) for Ras acting downstream of the Sevenless receptor. Two closely related homologs of Drosophila SOS are found in mammalian cells: SOS1 and SOS2. SOS1 consists of histone folds, Dbl (DH) and pleckstrin (PH) homology domains, a Ras exchange motif (REM), and Cdc25 homology and polyproline domains. SOS1 binds to GRB2, NCK, and other adaptor proteins, and plays an important role in ERK activation downstream of protein tyrosine kinase receptor (RTK). Research studies have identified mutations in the corresponding SOS1 gene of patients with Noonan syndrome, a developmental disorder characterized by short stature, facial dysmorphia, and congenital heart defects. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to the following amino acid sequence: PPVPLRPPEHFINCPFNLQPPPLGHLHRDSDWLRDISTCPNSPSTPPST. |
| Usage | |
|---|---|
| Application | IF |
| Dilutions | Immunofluorescence (0.25-2 µg/mL) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human SOS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.