Online Inquiry
SODD/BAG4 Antibody
SPA-00868
| Size | Price |
| 0.025 mg | Online Inquiry |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Bag-4 |
| Gene Abbr. | BAG4 |
| Gene ID | 9530 |
| Full Name | BAG cochaperone 4 |
| Alias | BAG-4, SODD |
| Introduction | Tumor necrosis factor receptor-1 (TNF-R1) and other TNF receptor superfamily members, such as DR3, contain intracellular death domains (DD) and are capable of initiating apoptosis when activated by their ligands. Silencer of Death Domains (SODD) was identified as being involved in the cellular mechanism to protect against ligand-independent signaling by TNF-R1 and other DD receptors. SODD, also known as Bcl-2-Associated Athanogene 4 (BAG4), is a 457 amino acid (aa), anti‑apoptotic protein that functions through interactions with a variety of proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors, and members of the heat shock protein 70 kDa family. SODD is a ubiquitously expressed, cytoplasmic protein that contains a C terminal BAG domain that can bind and inhibit the chaperone activity of Hsc70/Hsp70. The association of SODD with the DD of TNF-R1 prevents constitutive activation of the TNF-R1 signaling pathway. Binding of TNF to TNF-R1 releases SODD and permits adapter molecules such as TRADD to associate with TNF-R1 leading to the activation of TNF signaling pathways such as apoptosis and NF kappa B activation. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: VHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGNATSDHPNNQDQSSSLPEECVPSDESTPPSIKKIIHVLEKVQYLEQ. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human SODD/BAG4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.