Online Inquiry
SMYD3 Antibody
SPA-10160
| Size | Price |
| 100 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | SMYD3 |
| Gene Abbr. | SMYD3 |
| Gene ID | 64754 |
| Full Name | SET and MYND domain containing 3 |
| Alias | KMT3E, ZMYND1, ZNFN3A1, bA74P14.1 |
| Introduction | SMYD3 is a histone methyltransferase that plays a role in transcriptional regulation as a member of an RNA polymerase complex.[supplied by OMIM] |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptide directed towards the N terminal of human SMYD3The immunogen for this antibody is SMYD3. Peptide sequence PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGL. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB, ChIP |
| Dilutions | Western Blot (1:1000); Chromatin Immunoprecipitation (1:10-1:500) |
| Reactivity | Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.