Online Inquiry
Sin1/MAPKAP1 Antibody
SPA-10008
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Sin1/MAPKAP1 |
| Gene Abbr. | MAPKAP1 |
| Gene ID | 79109 |
| Full Name | MAPK associated protein 1 |
| Alias | JC310, MIP1, SIN1, SIN1b, SIN1g |
| Introduction | Cell growth is a fundamental biological process whereby cells accumulate mass and increase in size. The mammalian TOR (mTOR) pathway regulates growth by coordinating energy and nutrient signals with growth factor-derived signals. mTOR is a large protein kinase that is a component of two different complexes. The mTOR complex 1 (mTORC1), a target of rapamycin, contains mTOR, GβL, and raptor. mTORC2, insensitive to rapamycin, includes mTOR, GβL, Sin1, and rictor. The mTORC2 complex phosphorylates Ser473 of Akt/PKB in vitro. This phosphorylation is essential for full Akt/PKB activation. Furthermore, an siRNA knockdown of rictor inhibits Ser473 phosphorylation in 3T3-L1 adipocytes. mTORC2 has also been shown to phosphorylate the rapamycin-resistant mutants of S6K1, another effector of mTOR. In addition, phosphorylation of Sin1 at Thr86 by Akt/PKB was shown to regulate the activity of mTORC2 in adipocytes upon stimulation by growth factors. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: ATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQRKLNRRTSFSFQKEKKSGQ. |
| Usage | |
|---|---|
| Application | IF, IHC |
| Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:20-1:50) |
| MW(KDa) | 74, 78 |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human Sin1/MAPKAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.