Online Inquiry
Shc Antibody
SPA-09968
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Shc |
Gene Abbr. | SHC1 |
Gene ID | 6464 |
Full Name | SHC adaptor protein 1 |
Alias | SHC, SHCA |
Introduction | Shc possesses SH2 and PTB domains and serves as a scaffold protein in signaling for a variety of receptor tyrosine kinases. Shc exists in p46, p52 and p66 isoforms, which are produced by using alternative translation initiation sites or a differentially spliced message. In response to extracellular signals, the SH2 and PTB domains of Shc interact with the activated receptors, leading to phosphorylation of Shc on three different tyrosine residues: Tyr239, Tyr240 and Tyr317. GRB2/Sos binds to Shc phosphorylated at these sites, activating the Ras/Raf/MAPK pathway. Both Shc expression and its tyrosine phosphorylation play an essential and nonredundant role in thymic T cell development. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: PLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMG. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:50-1:200) |
MW(KDa) | 46, 52, 66 |
Reactivity | Human, Mouse, Rat |
Sensitivity | Endogenous |
Specificity | Specificity of human SHC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.