Online Inquiry
SGK3 Antibody
SPA-09940
Size | Price |
0.05 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | SGK3 |
Gene Abbr. | SGK3 |
Gene ID | 23678 |
Full Name | serum/glucocorticoid regulated kinase family member 3 |
Alias | CISK, SGK2, SGKL |
Introduction | Serum and glucocorticoid-inducible kinase (SGK) is a serine/threonine kinase closely related to Akt. SGK is rapidly induced in response to a variety of stimuli, including serum, glucocorticoid, follicle stimulating hormone, osmotic shock, and mineralocorticoids. SGK activation can be accomplished via HGF PI3K-dependent pathways and by integrin-mediated PI3K-independent pathways. Induction and activation of SGK has been implicated in activating the modulation of anti-apoptotic and cell cycle regulation. SGK also plays an important role in activating certain potassium, sodium, and chloride channels, suggesting its involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. SGK is negatively regulated by ubiquitination and proteasome degradation.SGK3 has been shown to be a downstream signaling molecule in the PI3K pathway. Its activation and phosphorylation at Thr320 by PDK1 may be an Akt-independent manner of signaling in cancer. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: DVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSY. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:20-1:50) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human SGK3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.