Rac1 Antibody - CD BioSciences

service-banner

Rac1 Antibody

Rac1 Antibody

SPA-09439

Size Price
0.1 mL Online Inquiry
0.025 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name Rac1/cdc42
Gene Abbr. RAC1
Gene ID 5879
Full Name Rac family small GTPase 1
Alias MIG5, MRD48, Rac-1, TC-25, p21-Rac1
Introduction Rac and Cdc42 are members of the Rho-GTPase family. In mammals, Rac exists as three isoforms, Rac1, Rac2 and Rac3, which are highly similar in sequence. Rac1 and Cdc42, the most widely studied of this group, are ubiquitously expressed. Rac2 is expressed in cells of hematopoietic origin, and Rac3, while highly expressed in brain, is also found in many other tissues. Rac and Cdc42 play key signaling roles in cytoskeletal reorganization, membrane trafficking, transcriptional regulation, cell growth and development. GTP binding stimulates the activity of Rac/Cdc42, and the hydrolysis of GTP to GDP through the protein's intrinsic GTPase activity, rendering it inactive. GTP hydrolysis is aided by GTPase activating proteins (GAPs), while exchange of GDP for GTP is facilitated by guanine nucleotide exchange factors (GEFs). Another level of regulation is achieved through the binding of RhoGDI, a guanine nucleotide dissociation inhibitor, which retains Rho family GTPases, including Rac and Cdc42, in their inactive GDP-bound state.A putative Akt phosphorylation site at Ser71 of Rac1/cdc42 has been identified and confirmed by in vitro kinase assay. Phosphorylation at this site may inhibit GTP binding of Rac1, attenuating the signal transduction pathway downstream of Rac1.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the middle region of human RAC1. Peptide sequence: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB, IHC
MW(KDa) 21
Reactivity Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Storage & Handling
Storage Buffer PBS, 2% sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.