Online Inquiry
RAB14 Antibody
SPA-09425
| Size | Price |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | RAB14 |
| Gene Abbr. | RAB14 |
| Gene ID | 51552 |
| Full Name | RAB14, member RAS oncogene family |
| Alias | FBP, RAB-14 |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptide directed towards the C terminal of human RAB14The immunogen for this antibody is RAB14. Peptide sequence FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB, IF, IHC |
| Dilutions | Western Blot (1:1000); Immunohistochemistry (1:10-1:500) |
| Reactivity | Human, Mouse, Rat, Porcine, Bovine, Canine, Goat, Zebrafish |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.