RAB14 Antibody - CD BioSciences

service-banner

RAB14 Antibody

RAB14 Antibody

SPA-09422

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name RAB14
Gene Abbr. RAB14
Gene ID 51552
Full Name RAB14, member RAS oncogene family
Alias FBP, RAB-14
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the C-terminal region of mouse RAB14. Peptide sequence: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Mouse
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.