Online Inquiry
Placental Lactogen/CSH1 Antibody
SPA-02435
| Size | Price |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | CSH1 |
| Gene Abbr. | CSH1 |
| Gene ID | 1442 |
| Full Name | chorionic somatomammotropin hormone 1 |
| Alias | CS-1, CSA, CSMT, GHB3, PL |
| Introduction | Placental lactogen is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:1000-1:2500) |
| Reactivity | Human |
| Specificity | Specificity of human Placental Lactogen/CSH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.