Online Inquiry
PKD3/PKCν Antibody
SPA-09115
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | PKD3/PKCν |
| Gene Abbr. | PRKD3 |
| Gene ID | 23683 |
| Full Name | protein kinase D3 |
| Alias | EPK2, PKC-NU, PKD3, PRKCN, nPKC-NU |
| Introduction | PKCν, also known as PKD3, is a member of the protein kinase C (PKC) family of serine/threonine kinases that play critical roles in the regulation of cellular differentiation and proliferation. PKCν is composed of 890 amino acid residues and has 77.3% similarity to human PKCμ (PKCμ) and 77. 4% similarity to mouse PKD (the mouse homolog of PKCμ). The PKCν mRNA is ubiquitously expressed in various tissues. PKCν has two putative diacylglycerol binding C1 domains, suggesting that it may participate in a novel diacylglycerol-mediated signaling pathway. PKCν is translocated to the plasma membrane and activated by the diacylglycerol mimic phorbol 12-myristate 13-acetate. PKCν is an important physiologic target of the B-cell receptor (BCR) and exhibits robust activation after BCR engagement. GPCR agonists induce a rapid activation of PKCν by a protein kinase C (PKC)-dependent pathway that leads to the phosphorylation of the activation loop of PKCν. PKCν is present both in the nucleus and cytoplasm and this distribution of PKCν results from its continuous shuttling between both compartments by a mechanism that requires a nuclear import receptor and a competent CRM1-nuclear export pathway. Cell stimulation with the GPCR agonist neurotensin induces a rapid and reversible plasma membrane translocation of PKCν that is PKC-dependent. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: ANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGM. |
| Usage | |
|---|---|
| Application | WB, IF, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:20-1:50) |
| MW(KDa) | 110 |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human, mouse PRKD3/nPKC nu antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.