Online Inquiry
PIP4K2A Antibody
SPA-08907
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | PIP4K2A |
Gene Abbr. | PIP4K2A |
Gene ID | 5305 |
Full Name | phosphatidylinositol-5-phosphate 4-kinase type 2 alpha |
Alias | PI5P4KA, PIP5K2A, PIP5KII-alpha, PIP5KIIA, PIPK |
Introduction | Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha (PtdIns 4-Kinase type II alpha, PIP4K2A), is one of three known members of the type II PIP kinase family, consisting of PIP4K2A, PIP4K2B, and PIP4K2C. Each catalyzes the phosphorylation of phosphatidylinositol 5-monophosphate (PI 5-P) to form phosphatidylinositol 4,5-bisphosphate (PI 4,5-P2). Originally thought to be a PI 4-P 5-Kinase, PIP4K2A was subsequently shown to phosphorylate the 4-position of PI 5-P, thus defining a new family of lipid kinases. Ubiquitously expressed with highest levels in the brain, mutations in PIP4K2A have been described in patients with Schizophrenia and other neuronal disorders.The levels of PI 5-P change significantly in response to physiological and pathological stimuli, as well as cell transformation with nucleophosmin anaplastic lymphoma tyrosine kinase. In contrast, hypoosmotic shock and histamine decrease cellular levels of PI 5-P. PIP4K2A has been hypothesized to play a role in suppressing mitogen-dependent increases in PI 5-P in response to DNA damage and cellular stress. PIP4K2A regulates the levels of PI 5-P in the nucleus by converting the PI 5-P to PI 4,5-P2, thus preventing PI 5-P from interacting with and regulating the ability of ING2 to activate p53 and p53-dependent apoptotic pathways. PIP4K2A has been shown to form a heterodimer with PIP4K2B resulting in its recruitment to the nucleus. Interestingly, PIP4K2A is 2000-fold more active than PIP4K2B in this context, suggesting that the two lipid kinases act in tandem, with PIP4K2B acting as the targeting subunit and PIP4K2A the catalytic component. PIP4Ks may also play a role in lipid vesicle formation and/or Golgi homeostasis. |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | 3A3 |
Isotype | IgG1 Kappa |
Immunogen | PIP5K2A (NP_005019, 304 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDILTHYD. |
Usage | |
---|---|
Application | WB, ELISA, IHC |
Dilutions | Western Blot (1:500) |
MW(KDa) | 50 |
Reactivity | Human |
Specificity | PIP5K2A - phosphatidylinositol-4-phosphate 5-kinase, type II, alpha. |
Storage & Handling | |
---|---|
Storage Buffer | In 1X PBS, pH 7.4. |
Preservative | No Preservative |
Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.