Online Inquiry
PHD-2/Egln1 Antibody
SPA-08819
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | PHD-2/Egln1 |
| Gene Abbr. | EGLN1 |
| Gene ID | 54583 |
| Full Name | egl-9 family hypoxia inducible factor 1 |
| Alias | C1orf12, ECYT3, HALAH, HIF-PH2, HIFPH2 |
| Introduction | PHD1 (Egln2), PHD-2 (Egln1), and PHD3 (Egln3) are members of the Egln family of proline hydroxylases. They function as oxygen sensors that catalyze the hydroxylation of HIF on prolines 564 and 402, initiating the first step of HIF degradation through the VHL/ubiquitin pathway. PHD1 is highly expressed in a wide array of tissues whereas PHD2 and PHD3 are expressed mainly in heart and skeletal muscle. The mRNA levels of PHD are upregulated by HIF through the hypoxia-response element under low oxygen conditions. These three enzymes also exhibit different peptide specificity target proteins, PHD1 and PHD2 can hydroxylate both proline 402 and proline 564, but PHD3 can only hydroxylate proline 564. In addition to HIF, PHD enzymes have also has been shown to catalyze the hydroxylation of RNA polymerase subunits and myogenin. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | This EGLN1/PHD2 antibody was developed against a recombinant protein corresponding to amino acids: GICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKING. |
| Usage | |
|---|---|
| Application | IF, IHC |
| Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:20-1:50) |
| MW(KDa) | 50 |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human EGLN1/PHD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2), 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.