Online Inquiry
PFKFB2 Antibody
SPA-08792
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | PFKFB2 |
| Gene Abbr. | PFKFB2 |
| Gene ID | 5208 |
| Full Name | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 |
| Alias | PFK-2/FBPase-2 |
| Introduction | The bifunctional 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFK/FBPase or PFKFB) catalyzes the synthesis and degradation of fructose 2,6-bisphosphate and regulates its steady-state level. Fructose 2,6-bisphosphate activates phosphofructokinase, a rate-limiting enzyme in glycolysis, by allosteric regulation. Four different PFKFB isoforms (PFKFB1, PFKFB2, PFKFB3, and PFKFB4) have been identified. Research studies indicate that amino acids activate PFKFB2 through Akt-dependent phosphorylation at Ser483 on PFKFB2. In addition, androgen increases the expression of PFKFB2 in prostate cancer cells. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptide directed towards the C terminal of human Pfkfb2The immunogen for this antibody is Pfkfb2. Peptide Sequence: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:1000) |
| MW(KDa) | 55 |
| Reactivity | Mouse, Human, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.