PDI Antibody - CD BioSciences

service-banner

PDI Antibody

PDI Antibody

SPA-08735

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name PDI
Gene Abbr. P4HB
Gene ID 5034
Full Name prolyl 4-hydroxylase subunit beta
Alias CLCRP1, DSI, ERBA2L, GIT, P4Hbeta
Introduction During their synthesis, secretory proteins translocate into the endoplasmic reticulum (ER) where they are post-translationally modified and properly folded. To reach their native conformation, many secretory proteins require the formation of intra- or inter-molecular disulfide bonds. This process is called oxidative protein folding. Protein disulfide isomerase (PDI) catalyzes the formation and isomerization of these disulfide bonds. Studies on mechanisms of oxidative folding suggest that molecular oxygen oxidizes the ER-protein Ero1, which in turn oxidizes PDI through disulfide exchange. This event is then followed by PDI-catalyzed disulfide bond formation in folding proteins.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to P4HB(procollagen-proline, 2-oxoglutarate 4-dioxygenase, beta polypeptide) The peptide sequence was selected from the N terminal of P4HB. Peptide sequence TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESL The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB, IHC
Dilutions Western Blot (1:100-1:2000); Immunohistochemistry (1:10-1:500)
MW(KDa) 57
Reactivity Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.