p90RSK/RSK1 Antibody - CD BioSciences

service-banner

p90RSK/RSK1 Antibody

p90RSK/RSK1 Antibody

SPA-08517

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name p90RSK
Gene Abbr. RPS6KA1
Gene ID 6195
Full Name ribosomal protein S6 kinase A1
Alias HU-1, MAPKAPK1, MAPKAPK1A, RSK, RSK1
Introduction The 90 kDa ribosomal S6 kinases (RSK1-4) are a family of widely expressed Ser/Thr kinases characterized by two nonidentical, functional kinase domains and a carboxy-terminal docking site for extracellular signal-regulated kinases (ERKs). Several sites both within and outside of the RSK kinase domain, including Ser380, Thr359, Ser363, and Thr573, are important for kinase activation. RSK1-3 are activated via coordinated phosphorylation by MAPKs, autophosphorylation, and phosphoinositide-3-OH kinase (PI3K) in response to many growth factors, polypeptide hormones, and neurotransmitters.
Product Details
Host Mouse
Clonality Monoclonal
Clone No. 2E3
Isotype IgG2B Kappa
Immunogen RPS6KA1 (NP_002944, 342 a.a. ~ 416 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSD.
Usage
Application WB, ELISA
MW(KDa) 90
Reactivity Human
Specificity RPS6KA1.
Storage & Handling
Storage Buffer In 1X PBS, pH 7.4.
Preservative No Preservative
Storage Temp. Aliquot and store at -20 °C or -80 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.