Online Inquiry
NFATC3/NFAT4 Antibody
SPA-08080
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | NFAT4 |
Gene Abbr. | NFATC3 |
Gene ID | 4775 |
Full Name | nuclear factor of activated T cells 3 |
Alias | NF-AT4c, NFAT4, NFATX |
Introduction | The NFAT (nuclear factor of activated T cells) family of proteins consists of NFAT1 (NFATc2 or NFATp), NFAT2 (NFATc1 or NFATc), NFAT3 (NFATc4), and NFAT4 (NFATc3 or NFATx). All members of this family are transcription factors with a Rel homology domain and regulate gene transcription in concert with AP-1 (Jun/Fos) to orchestrate an effective immune response. NFAT proteins are predominantly expressed in cells of the immune system, but are also expressed in skeletal muscle, keratinocytes, and adipocytes, regulating cell differentiation programs in these cells. In resting cells, NFAT proteins are heavily phosphorylated and localized in the cytoplasm. Increased intracellular calcium concentrations activate the calcium/calmodulin-dependent serine phosphatase calcineurin, which dephosphorylates NFAT proteins, resulting in their subsequent translocation to the nucleus. Termination of NFAT signaling occurs upon declining calcium concentrations and phosphorylation of NFAT by kinases such as GSK-3 or CK1. Cyclosporin A and FK506 are immunosuppressive drugs that inhibit calcineurin and thus retain NFAT proteins in the cytoplasm.NFAT4 upregulates the expression of several cytokine genes and activation markers and downregulates expression of CD154 in naive CD4(+) T cells. Furthermore, NFAT4 augments expression of IFN-gamma and TNF-alpha in helper T-cells 1 (Th1 cells) and attenuates expression of IL-4 and IL-5 in helper T-cells 2 (Th2 cells). |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to the following amino acid sequence: SHLPQLQCRDESVSKEQHMIPSPIVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSGLVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVADQITGQP. |
Usage | |
---|---|
Application | IF |
Dilutions | Immunofluorescence (0.25-2 µg/mL) |
MW(KDa) | 140-190 |
Reactivity | Human |
Specificity | Specificity of human NFATC3/NFAT4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.