Online Inquiry
MLK1/MAP3K9 Antibody
SPA-07658
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | MLK1 |
| Gene Abbr. | MAP3K9 |
| Gene ID | 4293 |
| Full Name | mitogen-activated protein kinase kinase kinase 9 |
| Alias | MEKK9, MLK1, PRKE1 |
| Introduction | Mixed-lineage kinases (MLKs) belong to the mitogen activated kinase kinase kinase (MAPKKK) family of dual-specificity protein kinases. While not particularly well conserved at the sequence level, MLK1, 2 and 3 share a conserved domain structure consisting of a catalytic core and two isoleucine/leucine zipper motifs among other protein-protein binding domains. MLK1 preferentially stimulates the JNK (c-Jun amino-terminal kinase) pathway in response to agonists and stress. Although multiple phosphorylation events are required for full activation of MLK1, two autophosphorylation sites within the activation loop (Ser308 and Thr312) appear to be the predominant activation residues. In neuronal cells, MLK1 appears to function downstream of the small G-proteins Rac1 and Cdc42 and upstream of MKK4 and MKK7 to promote apoptosis. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: EGSPQRREKANGLSTPSESPHFHLGLKSLVDGYKQWSSSAPNLVKGPRSSPALPGFTSLMEMEDEDSEGPGSGESRLQHSPSQSYLCIPFPRGEDGDGPSSDGIHEEPTPVNSATSTPQLTPTNSLKRGG. |
| Usage | |
|---|---|
| Application | IF, IHC |
| Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:50-1:200) |
| MW(KDa) | 120 |
| Reactivity | Human, Rat |
| Specificity | Specificity of human, MAP3K9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.