Online Inquiry
MIS/AMH Antibody
SPA-07589
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | MIS/AMH |
| Gene Abbr. | AMH |
| Gene ID | 268 |
| Full Name | anti-Mullerian hormone |
| Alias | MIF, MIS |
| Introduction | MIS, also known as anti-Müllerian hormone (AMH), belongs to the TGF-beta superfamily. It is produced by the fetal testis and plays a role in male sex differentiation. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to AMH(anti-Mullerian hormone) The peptide sequence was selected from the middle region of AMH. Peptide sequence SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (1:100-1:2000); Immunohistochemistry (1:10-1:500) |
| Reactivity | Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Sheep |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.