Mer Antibody - CD BioSciences

service-banner

Mer Antibody

Mer Antibody

SPA-07488

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name Mer
Gene Abbr. MERTK
Gene ID 10461
Full Name MER proto-oncogene, tyrosine kinase
Alias MER, RP38, Tyro12, c-Eyk, c-mer
Introduction Mer tyrosine kinase belongs to a receptor tyrosine kinase family with Axl and Tyro3. This family is characterized by a common NCAM (neural adhesion molecule)-related extracellular domain and a common ligand, GAS6 (growth arrest-specific protein 6). Mer protein has an apparent molecular weight of 170-210 kDa due to different glycosylation patterns generated in different cell types. Mer can be activated by dimerization and autophosphorylation through ligand binding or homophilic cell-cell interaction mediated by its NCAM-like motif. The downstream signaling components of activated Mer include PI3 kinase, PLCγ, and MAP kinase. Family members are prone to transcriptional regulation and carry out diverse functions including the regulation of cell adhesion, migration, phagocytosis, and survival. Mer regulates macrophage activation, promotes apoptotic cell engulfment, and supports platelet aggregation and clot stability in vivo. Investigators have found that overexpression of Mer may play a cooperative role in leukemogenesis and may be an effective target for biologically based leukemia/lymphoma therapy.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
MW(KDa) 210
Reactivity Human
Specificity Specificity of human Mer antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.