Online Inquiry
MEKK3 Antibody
SPA-07461
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | MEKK3 |
| Gene Abbr. | MAP3K3 |
| Gene ID | 4215 |
| Full Name | mitogen-activated protein kinase kinase kinase 3 |
| Alias | MAPKKK3, MEKK3 |
| Introduction | MAP kinase kinase kinase (MEKK3 or MAP3K3) is a serine/threonine protein kinase that activates SAPK and ERK via phosphorylation and activation of their respective MAP kinase kinases, SEK and MEK1/2. MEKK3 also stimulates MEK5 via activation of ERK5/BMK1, which is at least partly regulated by a direct interaction between MEK5 and MEKK3 via p67phox-Bem1p (PB1) protein-protein interaction domains found in both proteins. MEKK3 modulates NF-κB activation in response to a variety of agonists including TNFα, LPS, IL-1 and LPA. Despite reports showing that phosphorylation of MEKK3 at Ser526 within the activation loop is necessary for kinase activation, at least one study suggests that dual phosphorylation at Thr516 and Ser520 is required for LPA-stimulated IKKβ/NF-κB activation. Phosphorylation at Thr294 appears to negatively regulate MEKK3 by promoting 14-3-3β binding and inhibition of the kinase activity. Phosphorylation of MEKK3 at Thr294 is diminished upon treatment of cells with LPS or TNFα, further suggesting an inhibitory role for this site. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 1H3 |
| Isotype | IgG2A Kappa |
| Immunogen | MAP3K3 (AAH10464.1, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNEANVMLPYSGKEEPVLPVAMTLPLPGRGPRCGTAATEGGSSFVNAVVSVLQVGVTLMLYPVSKLETVCALWALSTPALGLGLGCIEK. |
| Usage | |
|---|---|
| Application | WB, ELISA |
| MW(KDa) | 78 |
| Reactivity | Human |
| Specificity | MAP3K3 - mitogen-activated protein kinase kinase kinase 3. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.