Online Inquiry
MEKK2 Antibody
SPA-07455
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | MEKK2 |
| Gene Abbr. | MAP3K2 |
| Gene ID | 10746 |
| Full Name | mitogen-activated protein kinase kinase kinase 2 |
| Alias | MEKK2, MEKK2B |
| Introduction | Mitogen-activated protein kinase kinase kinase 2 (MEKK2/MAP3K2) belongs to the MAP3K family of Ser/Thr kinases. Research studies have demonstrated that MEKK2 plays a pivotal role in transducing mitogenic signals emanating from EGFR and FGF2R to JNK and ERK5 signaling cascades. Post-translationally MEKK2 is regulated through multiple mechanisms including: dimerization, ubiquitination, phosphorylation and methylation. Research studies implicate dysregulation of MEKK2 signaling in breast carcinoma colorectal carcinoma and pancreatic ductal adenocarcinoma. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: IAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPESMDQM. |
| Usage | |
|---|---|
| Application | WB, IF, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500) |
| MW(KDa) | 78 |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human MEKK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.