Online Inquiry
Mcl-1 Antibody
SPA-07289
| Size | Price |
| 100 µL | Online Inquiry |
| 20 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Mcl-1 |
| Gene Abbr. | MCL1 |
| Gene ID | 4170 |
| Full Name | MCL1 apoptosis regulator, BCL2 family member |
| Alias | BCL2L3, EAT, MCL1-ES, MCL1L, MCL1S |
| Introduction | Mcl-1 is an anti-apoptotic member of the Bcl-2 family originally isolated from the ML-1 human myeloid leukemia cell line during phorbol ester-induced differentiation along the monocyte/macrophage pathway. Similar to other Bcl-2 family members, Mcl-1 localizes to the mitochondria interacts with and antagonizes pro-apoptotic Bcl-2 family members and inhibits apoptosis induced by a number of cytotoxic stimuli. Mcl-1 differs from its other family members in its regulation at both the transcriptional and post-translational level. First, Mcl-1 has an extended amino-terminal PEST region, which is responsible for its relatively short half-life. Second, unlike other family members, Mcl-1 is rapidly transcribed via a PI3K/Akt dependent pathway, resulting in its increased expression during myeloid differentiation and cytokine stimulation.Mcl-1 is phosphorylated in response to treatment with phorbol ester, microtubule-damaging agents, oxidative stress, and cytokine withdrawal. Phosphorylation at Thr163, the conserved MAP kinase/ERK site located within the PEST region, slows Mcl-1 protein turnover but may prime the GSK-3 mediated phosphorylation at Ser159 that leads to Mcl-1 destabilization. Mcl-1 deficiency in mice results in peri-implantation lethality. In addition, conditional disruption of the corresponding mcl-1 gene shows that Mcl-1 plays an important role in early lymphoid development and in the maintenance of mature lymphocytes. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | CL1128 |
| Isotype | IgG1 |
| Immunogen | Recombinant Protein corresponding to amino acids: DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG. |
| Usage | |
|---|---|
| Application | WB, IF, IHC |
| Dilutions | Western Blot (1 µg/mL); Immunofluorescence (2-10 µg/mL); Immunohistochemistry (1:500-1:1000) |
| MW(KDa) | 40 |
| Reactivity | Human |
| Specificity | Specificity of human Mcl-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.