Online Inquiry
Leptin/OB Antibody
SPA-06958
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Leptin |
Gene Abbr. | LEP |
Gene ID | 3952 |
Full Name | leptin |
Alias | LEPD, OB, OBS |
Introduction | Leptin, the obese (ob) gene product, is a small protein expressed in and secreted from adipose tissue of normal rodents. Studies suggest leptin acts as a circulating hormone capable of regulating body-weight homeostasis and energy balance. One possible target tissue for leptin is the hypothalamus, a proposed control center for satiety and energy expenditure. Ob gene knockout mice are characterized by several metabolic abnormalities including hyperglucocorticoidemia, hyperinsulinemia and insulin resistance, hyperglycemia, altered central nervous system activity, reduced metabolic rate of brown adipose tissue, and a large increase in white adipose tissue. Studies show that the administration of recombinant leptin to ob knockout mice reduces food intake and increases energy expenditure. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Synthetic peptides corresponding to LEP(leptin) The peptide sequence was selected from the middle region of LEP (NP_000221). Peptide sequence LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM. The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB, IF, IHC |
Dilutions | Western Blot (0.2-1 µg/mL); Immunofluorescence (1:10-1:500); Immunohistochemistry (4-8 µg/mL) |
Reactivity | Human, Mouse, Rat |
Storage & Handling | |
---|---|
Storage Buffer | PBS and 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at -20 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.