Online Inquiry
LAMTOR3/MAPKSP1 Antibody
SPA-06907
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | LAMTOR3 |
| Gene Abbr. | LAMTOR3 |
| Gene ID | 8649 |
| Full Name | late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 |
| Alias | MAP2K1IP1, MAPBP, MAPKSP1, MP1, PRO0633 |
| Introduction | mTORC1 kinase complex is a critical component in the regulation of cell growth. Its activity is modulated by energy levels, growth factors, and amino acids. The four related GTPases, RagA, RagB, RagC, and RagD, have been shown to interact with raptor in mTORC1. These interactions are both necessary and sufficient for mTORC1 activation in response to amino acid signals. A protein complex consisting of LAMTOR1/C11orf59, LAMTOR2/ROBLD3, and LAMTOR3/MAPKSP1 has been identified to interact with and recruit the four Rag GTPases to the surface of lysosomes. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:20-1:50) |
| MW(KDa) | 14 |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human MP1/MAP2K1IP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.