KDM2A/FBXL11 Antibody - CD BioSciences

service-banner

KDM2A/FBXL11 Antibody

KDM2A/FBXL11 Antibody

SPA-06830

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name KDM2A/FBXL11
Gene Abbr. KDM2A
Gene ID 22992
Full Name lysine demethylase 2A
Alias CXXC8, FBL11, FBL7, FBXL11, JHDM1A
Introduction KDM2A/FBXL11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbls class and, in addition to an F-box, contains at least 6 highly degenerated leucine-rich repeats.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the middle region of Human KDM2A. Peptide sequence: LTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLS The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.