JMJD2D Antibody - CD BioSciences

service-banner

JMJD2D Antibody

JMJD2D Antibody

SPA-06763

Size Price
0.025 mL Online Inquiry
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name JMJD2D
Gene Abbr. KDM4D
Gene ID 55693
Full Name lysine demethylase 4D
Alias JMJD2D
Introduction Jumonji lysine demethylases (JMJDs) are oxygenases catalyzing the demethylation of mono-, di-, or trimethylated lysines, and its members (JMJD2A, JMJD2B, JMJD2C, and JMJD2D/ KDM4D) are Fe(II)-/alpha-ketoglutarate-dependent enzymes harboring a JmjC catalytic domain. JMJD2 shows differential substrate specificities and unlike, JMJD2A, JMJD2B, and JMJD2C that efficiently demethylate H3K9me3 as well as H3K36me3, JMJD2D is specific for H3K9me3 site. These enzymes have been implicated in transcriptional regulation, cell-cycle progression, nuclear hormone signaling, embryonic stem cell self-renewal and development. Overexpression of several JMJD2 homologs has been linked to cancer e.g. JMJD2D, JMJD2A and JMJD2C are overexpressed in prostate cancer wherein they function as AR coactivators to upregulate AR target genes and JMJD2D has been shown to function as a pro-proliferative protein in colon cancer cells. JMJD2D has also been reported to interact with the ligand binding domain of AR and thereby activate AR gene transcription.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: LRQLPSHWARHSPWPMAARSGTRCHTLVCSSLPRRSAVSGTATQPRAAAVHSSKKPSSTPSSTPGPSAQIIHPSN.
Usage
Application IF, IHC
Dilutions Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:20-1:50)
Reactivity Human
Specificity Specificity of human JMJD2D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.