Online Inquiry
JMJD2D Antibody
SPA-06763
Size | Price |
0.025 mL | Online Inquiry |
0.1 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | JMJD2D |
Gene Abbr. | KDM4D |
Gene ID | 55693 |
Full Name | lysine demethylase 4D |
Alias | JMJD2D |
Introduction | Jumonji lysine demethylases (JMJDs) are oxygenases catalyzing the demethylation of mono-, di-, or trimethylated lysines, and its members (JMJD2A, JMJD2B, JMJD2C, and JMJD2D/ KDM4D) are Fe(II)-/alpha-ketoglutarate-dependent enzymes harboring a JmjC catalytic domain. JMJD2 shows differential substrate specificities and unlike, JMJD2A, JMJD2B, and JMJD2C that efficiently demethylate H3K9me3 as well as H3K36me3, JMJD2D is specific for H3K9me3 site. These enzymes have been implicated in transcriptional regulation, cell-cycle progression, nuclear hormone signaling, embryonic stem cell self-renewal and development. Overexpression of several JMJD2 homologs has been linked to cancer e.g. JMJD2D, JMJD2A and JMJD2C are overexpressed in prostate cancer wherein they function as AR coactivators to upregulate AR target genes and JMJD2D has been shown to function as a pro-proliferative protein in colon cancer cells. JMJD2D has also been reported to interact with the ligand binding domain of AR and thereby activate AR gene transcription. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: LRQLPSHWARHSPWPMAARSGTRCHTLVCSSLPRRSAVSGTATQPRAAAVHSSKKPSSTPSSTPGPSAQIIHPSN. |
Usage | |
---|---|
Application | IF, IHC |
Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:20-1:50) |
Reactivity | Human |
Specificity | Specificity of human JMJD2D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.