JMJD2B Antibody - CD BioSciences

service-banner

JMJD2B Antibody

JMJD2B Antibody

SPA-06754

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name JMJD2B
Gene Abbr. KDM4B
Gene ID 23030
Full Name lysine demethylase 4B
Alias JMJD2B, TDRD14B
Introduction The methylation state of lysine residues in histone proteins is a major determinant of the formation of active and inactive regions of the genome and is crucial for proper programming of the genome during development. Jumonji C (JmjC) domain-containing proteins represent the largest class of potential histone demethylase proteins. The JmjC domain can catalyze the demethylation of mono-, di-, and tri-methyl lysine residues via an oxidative reaction that requires iron and α-ketoglutarate. Based on homology, both humans and mice contain at least 30 such proteins, which can be divided into 7 separate families. The jumonji domain-containing protein 2 (JMJD2) family, also known as the JmjC domain-containing histone demethylation protein 3 (JHDM3) family, contains four members: JMJD2A/JHDM3A, JMJD2B/JHDM3B, JMJD2C/JHDM3C, and JMJD2D/JHDM3D. In addition to the JmjC domain, these proteins also contain JmjN, PHD, and tudor domains, the latter of which has been shown to bind to methylated histone H3 at Lys4 and Lys9, and methylated histone H4 at Lys20. JMJD2 proteins have been shown to demethylate di- and tri-methyl histone H3 at Lys9 and Lys36 and function as both activators and repressors of transcription. JMJD2A, JMJD2C, and JMJD2D function as coactivators of the androgen receptor in prostate tumor cells. In contrast, JMJD2A also associates with Rb and NCoR corepressor complexes and is necessary for transcriptional repression of target genes. JMJD2B antagonizes histone H3 Lys9 tri-methylation at pericentric heterochromatin. JMJD2C, also known as GASC1, is amplified in squamous cell carcinomas and metastatic lung carcinoma and inhibition of JMJD2C expression decreases cell proliferation. JMJD2C has also been identified as a downstream target of Oct-4 and is critical for the regulation of self-renewal in embryonic stem cells.Recent studies have demonstrated that JMJD2B is physically associated with and an integral component of the mixed-lineage leukemia (MLL) 2 H3K4 methyltransferase complex. JMJD2B also interacts with estrogen receptor α (ERα) and members of a chromatin remodeling complex, SWI/SNF-B. It is likely that JMJD2B removes repressive histone marks at ERα binding sites, which may also generate docking sites for enzymes and transcription factors that remodel chromatin in order to facilitate ERα-mediated transcription. Of note, JMJD2B is expressed in a high percentage of human breast tumors and its expression positively correlates with ERα expression. Researchers have shown that JMJD2B is a transcriptional target of ERα and may participate in a feed-forward regulatory loop involved in driving estrogen responsive breast tumor formation.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: SRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVAFVESLLQVQG.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human
Specificity Specificity of human JMJD2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.