JIP1 Antibody - CD BioSciences

service-banner

JIP1 Antibody

JIP1 Antibody

SPA-06705

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name JIP1
Gene Abbr. MAPK8IP1
Gene ID 9479
Full Name mitogen-activated protein kinase 8 interacting protein 1
Alias IB1, JIP-1, JIP1, PRKM8IP
Introduction JNK-interacting proteins (JIPs) comprise a family of four scaffolding proteins that tether and assemble components of the JNK signaling cascade. JIP1, also known as islet-brain 1 (IB1) and mitogen-activated protein kinase 8-interacting protein 1 (MAPK8IP1), contains an N-terminal JNK-binding domain, and C-terminal MLK- and MKK7-binding domains. JIP1 is ubiquitously expressed, with highest levels in brain and in pancreatic beta -cells. Mice lacking JIP1 are resistant to diet-induced obesity and show reduced diet-induced insulin resistance.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: GVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLC.
Usage
Application WB, IF
Dilutions Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL)
Reactivity Human, Mouse, Rat
Specificity Specificity of human JIP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.