JAMP Antibody - CD BioSciences

service-banner

JAMP Antibody

JAMP Antibody

SPA-06690

Size Price
0.025 mL Online Inquiry
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name JAMP
Gene Abbr. JKAMP
Gene ID 51528
Full Name JNK1/MAPK8 associated membrane protein
Alias C14orf100, C24orf100, CDA06, HSPC213, HSPC327
Introduction JAMP, better known as the JNK1/MAPK8 associated membrane protein, is a regulator of MAPK8 activity in response to various stress stimuli. This regulation is part of a broader response to ER stress which induces JAMP to facilitate the degradation of misfolded ER luminal proteins via recruitment of the ERAD (endoplasmic reticulum-associated degradation system). Aside from interactions with MAPK8, JAMP also interacts with RNF5, as well as many regulatory proteins in the ERAD such as AMFR/GP78, CANX, PSMC1/PSMC2 and PSMC5-8. JAMP is expressed in many tissues, including brain, spleen, thymus, liver, kidney and testis. It also exhibits elevated expression in medulloblastomas. JAMP undergoes a post-translational modification after ubiquitination by RNF5 in a UBE2N-dependent manner, which ultimately decreases association with the proteasome and ERAD. Research has confirmed that JAMP regulates JNK-1 activity as well as optimizes ERAD to protect cells from unfolded proteins which may have various implications in disease models.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: TFRRPMAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYD.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human, Mouse, Rat
Specificity Specificity of human JAMP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.