Online Inquiry
Integrin β-like protein 1 Antibody
SPA-06392
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Integrin |
| Gene Abbr. | ITGBL1 |
| Gene ID | 9358 |
| Full Name | integrin subunit beta like 1 |
| Alias | OSCP, TIED |
| Introduction | Integrins are α/β heterodimeric cell surface receptors that play a pivotal role in cell adhesion and migration, as well as in growth and survival. The integrin family contains at least 18 α and 8 β subunits that form 24 known integrins having distinct tissue distribution and overlapping ligand specificities. Integrins not only transmit signals to cells in response to the extracellular environment (outside-in signaling), but also sense intracellular cues to alter their interaction with extracellular environment (inside-out signaling). |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptides corresponding to ITGBL1(integrin, beta-like 1 (with EGF-like repeat domains)) The peptide sequence was selected from the N terminal of ITGBL1. Peptide sequence MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:100-1:2000) |
| Reactivity | Human, Rat, Porcine, Canine, Equine |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.