Online Inquiry
Integrin β8 Antibody
SPA-06386
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Integrin |
Gene Abbr. | ITGB8 |
Gene ID | 3696 |
Full Name | integrin subunit beta 8 |
Introduction | Integrins are α/β heterodimeric cell surface receptors that play a pivotal role in cell adhesion and migration, as well as in growth and survival. The integrin family contains at least 18 α and 8 β subunits that form 24 known integrins having distinct tissue distribution and overlapping ligand specificities. Integrins not only transmit signals to cells in response to the extracellular environment (outside-in signaling), but also sense intracellular cues to alter their interaction with extracellular environment (inside-out signaling). |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | CL7290 |
Isotype | IgG1 |
Immunogen | Recombinant Protein corresponding to amino acids: AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHY. |
Usage | |
---|---|
Application | WB, IF |
Dilutions | Western Blot (1.0 µg/mL); Immunofluorescence (2-10 µg/mL) |
Reactivity | Human |
Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS, pH 7.2, containing 40% glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.