Integrin α6 Antibody - CD BioSciences

service-banner

Integrin α6 Antibody

Integrin α6 Antibody

SPA-06152

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name Integrin
Gene Abbr. ITGA6
Gene ID 3655
Full Name integrin subunit alpha 6
Alias CD49f, ITGA6B, VLA-6
Introduction Integrins are α/β heterodimeric cell surface receptors that play a pivotal role in cell adhesion and migration, as well as in growth and survival. The integrin family contains at least 18 α and 8 β subunits that form 24 known integrins with distinct tissue distribution and overlapping ligand specificities. Integrins not only transmit signals to cells in response to the extracellular environment (outside-in signaling), but also sense intracellular cues to alter their interaction with the extracellular environment (inside-out signaling).Integrin α6 is a 120 kDa protein with two splice variants, integrin α6, 6A and 6B which function as receptors for laminins on the basal membrane to mediate cellular adhesion events. α6 integrins have been shown to play an important role in hematopoietic stem and progenitor cell homing to the bone marrow.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS.
Usage
Application WB, IHC, IP
Dilutions Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:200-1:500); Immunoprecipitation (1:10-1:500)
MW(KDa) 150, 125
Reactivity Human, Mouse, Rat
Specificity Specificity of human Integrin alpha 6/CD49f antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.