Online Inquiry
Integrin β5 Antibody
SPA-06357
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Integrin |
Gene Abbr. | ITGB5 |
Gene ID | 3693 |
Full Name | integrin subunit beta 5 |
Introduction | Integrins are α/β heterodimeric cell surface receptors that play a pivotal role in cell adhesion and migration, as well as in growth and survival. The integrin family contains at least 18 α and 8 β subunits that form 24 known integrins having distinct tissue distribution and overlapping ligand specificities. Integrins not only transmit signals to cells in response to the extracellular environment (outside-in signaling), but also sense intracellular cues to alter their interaction with extracellular environment (inside-out signaling).The αVβ5 integrin is expressed in various tissues and cell types, including endothelia, epithelia and fibroblasts. It plays a role in matrix adhesion to VN, FN, SPARC and bone sialoprotein and functions in the invasion of gliomas and metastatic carcinoma cells. αVβ5 integrin plays a major role in growth-factor-induced tumor angiogenesis, where cooperative signaling by the αVβ5 integrin and growth factors regulates endothelial cell proliferation and survival. |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | 1D8 |
Isotype | IgG1 Kappa |
Immunogen | ITGB5 (NP_002204, 421 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA. |
Usage | |
---|---|
Application | WB, ELISA |
MW(KDa) | 90 |
Reactivity | Human |
Storage & Handling | |
---|---|
Storage Buffer | In 1X PBS, pH 7.4. |
Preservative | No Preservative |
Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.