Integrin α3/CD49c Antibody - CD BioSciences

service-banner

Integrin α3/CD49c Antibody

Integrin α3/CD49c Antibody

SPA-06102

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name Integrin
Gene Abbr. ITGA3
Gene ID 3675
Full Name integrin subunit alpha 3
Alias CD49C, FRP-2, GAP-B3, GAPB3, ILNEB
Introduction Integrins are α/β heterodimeric cell surface receptors that play a pivotal role in cell adhesion and migration, as well as in growth and survival. The integrin family contains at least 18 α and 8 β subunits that form 24 known integrins with distinct tissue distribution and overlapping ligand specificities. Integrins not only transmit signals to cells in response to the extracellular environment (outside-in signaling), but also sense intracellular cues to alter their interaction with the extracellular environment (inside-out signaling).
Product Details
Host Mouse
Clonality Monoclonal
Clone No. 29A3
Isotype IgG1
Immunogen Clone 29A3 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Usage
Application WB, IF, IHC
Dilutions Western Blot (1:100-1:1000); Immunofluorescence (1:10-1:500); Immunohistochemistry (1:10-1:500)
Reactivity Human
Specificity 29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
Storage & Handling
Storage Buffer PBS, pH 7.2.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.