Integrin α2/CD49b Antibody - CD BioSciences

service-banner

Integrin α2/CD49b Antibody

Integrin α2/CD49b Antibody

SPA-06064

Size Price
100 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name Integrin
Gene Abbr. ITGA2
Gene ID 3673
Full Name integrin subunit alpha 2
Alias BR, CD49B, GPIa, HPA-5, VLA-2
Introduction Integrins are α/β heterodimeric cell surface receptors that play a pivotal role in cell adhesion and migration, as well as in growth and survival. The integrin family contains at least 18 α and 8 β subunits that form 24 known integrins with distinct tissue distribution and overlapping ligand specificities. Integrins not only transmit signals to cells in response to the extracellular environment (outside-in signaling), but also sense intracellular cues to alter their interaction with the extracellular environment (inside-out signaling).Integrin α1 (CD49a, VLA-1, ITGA1) pairs with integrin β1 to form an α1β1 dimer on the cell surface. This integrin dimer plays important roles in colorectal cancer and pancreatic cancer cell proliferation, migration, and metastasis. The cytoplasmic tail of integrin α1 activates ERK and FAK/Src signaling to promote these biological processes.
Product Details
Host Mouse
Clonality Monoclonal
Clone No. 2B6
Isotype IgG1 Kappa
Immunogen ITGA2 (NP_002194.2, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL.
Usage
Application WB, ELISA, IF
Dilutions Western Blot (1:500)
Reactivity Human
Specificity ITGA2 - integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor).
Storage & Handling
Storage Buffer In 1X PBS, pH 7.4.
Preservative No Preservative
Storage Temp. Aliquot and store at -20 °C or -80 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.